PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G053800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family B3
Protein Properties Length: 346aa    MW: 38372.2 Da    PI: 8.946
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G053800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3331.1e-1075165598
                         -..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                  B3   5 ltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                         l+++ ++k+g   +p kf+e++  +++++s++ ++  + g+  +v+l  + + +  +l++GW++   ++++ +   +++k++g++ f  +v
  Seita.7G053800.1.p  75 LVTPPTGKKGFRLIPAKFVEHYiPEEHKNSRMAMVIGSLGKICRVEL--EMNESNLFLRGGWSQVLVSHDVTQANALLLKYEGNTVF--TV 161
                         688999999999*******999*555568889***************..999999***************************99999..88 PP

                         EEE- CS
                  B3  95 kvfr 98 
                         kvf 
  Seita.7G053800.1.p 162 KVFG 165
                         8875 PP

2B336.68.2e-122002524386
                         S..........-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3  43 g..........rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         g          +sW+v    +k+ +++v+++GW  F+++n LkegD+++F  ++
  Seita.7G053800.1.p 200 GykcetsmnstESWKVGGLPCKN-NSFVIARGWMMFCRENSLKEGDICTFNIVE 252
                         255555555559******54444.469***********************9654 PP

3B348.61.5e-152613341386
                         TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         +++ +lp  f++++g+ +++++tl+   ++ rsW+v +  +k+s++yv +  Wk+F+++n++k+gD+++++ ++
  Seita.7G053800.1.p 261 THNKYLPYAFCDAIGLREPRTITLKTSMSNTRSWQVLVVPNKNSSHYVRGLDWKRFCEENEIKVGDVCTISIVE 334
                         45589************88876666666778*******99*****************************99654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508638.332169IPR003340B3 DNA binding domain
SuperFamilySSF1019361.51E-81171IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-71271IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.12271167IPR003340B3 DNA binding domain
SMARTSM010196.0E-672167IPR003340B3 DNA binding domain
PfamPF023629.5E-875164IPR003340B3 DNA binding domain
CDDcd100171.18E-776164No hitNo description
SuperFamilySSF1019361.26E-1184168IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-1085167IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.4E-11209262IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.25211264IPR003340B3 DNA binding domain
SuperFamilySSF1019361.26E-9211262IPR015300DNA-binding pseudobarrel domain
CDDcd100174.74E-7221248No hitNo description
SMARTSM010197.5E-4250345IPR003340B3 DNA binding domain
CDDcd100179.32E-11257330No hitNo description
PfamPF023628.8E-14258340IPR003340B3 DNA binding domain
SuperFamilySSF1019369.42E-14263344IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.4E-13265344IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.505266345IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
VGAGKARVVG PSGGKVKVWR VEVGRDGDGA FLGRGWPEIA AAFGVGDGWF LVLQHHGGSV  60
LTLKAFDASG CIRGLVTPPT GKKGFRLIPA KFVEHYIPEE HKNSRMAMVI GSLGKICRVE  120
LEMNESNLFL RGGWSQVLVS HDVTQANALL LKYEGNTVFT VKVFGPDGFQ RESKDKDIRI  180
QQGEQKINPS MVVFESVSSG YKCETSMNST ESWKVGGLPC KNNSFVIARG WMMFCRENSL  240
KEGDICTFNI VETTLWHVVI THNKYLPYAF CDAIGLREPR TITLKTSMSN TRSWQVLVVP  300
NKNSSHYVRG LDWKRFCEEN EIKVGDVCTI SIVETTLWHV VVARQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977883.11e-140PREDICTED: putative B3 domain-containing protein Os04g0347400
TrEMBLA0A0A9VAH11e-101A0A0A9VAH1_ARUDO; Uncharacterized protein
STRINGSi012721m1e-93(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31690.11e-15B3 family protein